SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V633 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V633
Domain Number 1 Region: 225-475
Classification Level Classification E-value
Superfamily Caspase-like 2.69e-77
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 88-172
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000408
Family DEATH effector domain, DED 0.024
Further Details:      
 
Domain Number 3 Region: 1-78
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000706
Family DEATH effector domain, DED 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2V633
Sequence length 476
Comment (tr|H2V633|H2V633_TAKRU) Caspase 8, apoptosis-related cysteine peptidase, like 2 {ECO:0000313|Ensembl:ENSTRUP00000044667} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRKLLYSLSEELTADDLKDIKFLLNNKLPR
GKLEEVVSTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNAQNSITEHRL
SLEADADAPLHICNCHPVKSDASVIFPQENQTSPGAETSVTGSADAGVETYLMTAAKRGR
CLIINNCNFRVSRLKKREGTMVDEASLDKVLKWLGFEVEIQRDCTSKKMSSLIQELAKTS
QRDWDCVMCCVLSHGLEGGVYGVDGGTVEIRKLMEPFSGTNCPSLAGKPKIFFIQACQGS
RQQDIVYTDAGTPGHGYVDNNAVQAKECIPSHADFLLGMATVPSFVSFRDGTHGTWYIQS
LCQNLADMVPRGCDLISILTKVNADVSKKVAWIDSGHKTQMPQPAFTLTKKIVFPA
Download sequence
Identical sequences H2V633
ENSTRUP00000044667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]