SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V6J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V6J2
Domain Number 1 Region: 385-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.22e-31
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Domain Number 2 Region: 86-235,375-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-16
Family HI0933 N-terminal domain-like 0.098
Further Details:      
 
Domain Number 3 Region: 962-994
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000111
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2V6J2
Sequence length 1026
Comment (tr|H2V6J2|H2V6J2_TAKRU) Microtubule associated monooxygenase, calponin and LIM domain containing 2a {ECO:0000313|Ensembl:ENSTRUP00000044828} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=mical2 OC=Takifugu.
Sequence
MGEMEEERDNVGKLFENFFQASTCKGTLQAFSLLCGQLDLDPADSSTFYSSLKAKVTTWK
AKALWSKLDKRMSHKEYKKGQACVGTKCLIIGGGPCGLRTAIEMALMGAKVVVIEKRDSF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIQQLQLILLKVALIVAVEFHISV
EFVKLLEPPEDQDNEGIGWRAAVQPADHPVANFEFDVVVGADGRRNTLEGFKRKEFRGKL
AIAITANFINRNTTAEAKVEEISGVAFIFNQKFFLDLKEETGIDLENIVYYRDNTHYFVM
TAKKQSLLDKGVIINDYTETQMLLSNENVDQEALQCYAREAADFGTNYQLPTLDYAMNHC
GQPDVAMFDFTSMHASENAALVRERFGHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDT
AWMVNSWAQGHTVLDVLAERESIYRLLPQTTAENIAKNFEQYTIDPGTRYPNLNCCNVRP
HQVRHLYIRGELSACSLERAATIRRPVNLSRRESDVRPSRLLTWCQKQTEGYRNVSITDL
TSSWISGLALCALIHRFKPQLIDFDSLHGEDHAANLQLAFDVSEREFGFRPFTSVEELHG
GQELDKTKMITYLSKFYELFRGTPLPASAGSRGADENNEDYPSKQVRSNNFLNLASTRKR
VPKDEKKSEGLDPLYKRKRKFYLEEATNLSSNGSLTREPRENKVRSMATQLLAKFESTPR
YTVRNSQLQFVSSFKFKMSLSEAAGNLVHLPPQCLRKPKSQPQPQFPVVRLRHVEGARRQ
AAPDPPPESDGASAAAPSRRSAVEFMTRVLQRLREVDEHVSEKKAQAQQAREFHKKSIKE
KAVHLSGLFTGGGSAQPKVTGCLTPPPHPGLGATCLLSPAHLHVERRHVARSSPFFRVQC
FLPSHLQLFLFSTITFTHAELAAGGSGCLSACDEVIVYLKLTVSTPATSAVPFQGDSVRR
AFPPSGDKCHSCGRRVYMVERLRAEGLYFHRECFRCSACGCTLRQGAHAFDSEHGRCCQL
YCQLHF
Download sequence
Identical sequences H2V6J2
31033.ENSTRUP00000044828 ENSTRUP00000044828 ENSTRUP00000044828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]