SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V7Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V7Y9
Domain Number 1 Region: 424-642
Classification Level Classification E-value
Superfamily ARM repeat 0.000000093
Family HEAT repeat 0.081
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000312
Family Galactose-binding domain 0.084
Further Details:      
 
Weak hits

Sequence:  H2V7Y9
Domain Number - Region: 203-245
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00732
Family C-terminal UvrC-binding domain of UvrB 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2V7Y9
Sequence length 894
Comment (tr|H2V7Y9|H2V7Y9_TAKRU) Centrosomal protein 104 {ECO:0000313|Ensembl:ENSTRUP00000045328} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MPRKIGFTVVDSSSHEENFSASELMHHAPTVSGWRSSRLCSYPQHITLQLVERSWVRKLQ
LLAHQYLIPTKVEFHIGDTPPDASSPGFPGQLCGLGCVSLCNNENTSFKARELKSGHVDA
FGTYLRITFHRNHVNRYNKYNQVALIAFNVLGETVDGREFNTVPSRGQLIEHDLNSTQLE
ATLDTFMGNYDSISLLDDLAFDMYQDPEVAHIIRVLDQKKQEAVRQENYEEAKNLKQAIA
DLQKVGEMLARYDVEKQCAIEKRDYELAKKKQELMEDYRRRVYQQLEVYNLLDMAMSVLQ
IMTALKSSSGRHPSSLQSSPGHCAAPTKALLSTETLRSSPQGQSSDAGSVAPHSSSLPVS
PCSPSAASHTDVADVPYDERPLPTLQSPAEQHSPLSDTQRSPNGLDMSGEPEPLSEMAQR
QAGLAVEVFGESLVACAYSKTWGYRESAMLNVYKKLLGLSPNTSKEELRNMIRAAVFLVK
RALLDKVSPVFHAALKLLRLLLSQLLSGLGRTEMSRCLEQTWPSLLARTGGPSAHLRAAV
TAFILEIAVLKDVRALHIIPGELVKPFRSSVPPRLAQSRVEMVEKLLAELGTENSGFTLE
NVMTFCTAAMVHSAPVVREVAVRIILLVYRQHGAAVVSYLPPRDAAVRKNFLYKTLFNEF
AKIDGKLVETQARIPHLVLHHENTEEGEIQRTEKCKHVCVPTVGCHDVQTVPSSQGWETK
AMEKRSRKMRPSLRNIPKKSLNHLDKLCIFCGETDESFTDEGLDLHYWTHCPMLRHCDEC
KQVVEIASVTEHLLSECGSRSKFRQCVRCSEAVLAEDLPRHAQGPTCNPPTSGKASSHCP
LCHNNFMPGDEAWKAHLMARGGCKQNSRRPAASQRSLPTQGKAFMAPPLTRSSP
Download sequence
Identical sequences H2V7Y9
ENSTRUP00000045328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]