SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2XSL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2XSL2
Domain Number 1 Region: 315-401
Classification Level Classification E-value
Superfamily RING/U-box 7.06e-16
Family RING finger domain, C3HC4 0.0014
Further Details:      
 
Domain Number 2 Region: 56-161
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000903
Family WWE domain 0.0037
Further Details:      
 
Weak hits

Sequence:  H2XSL2
Domain Number - Region: 9-72
Classification Level Classification E-value
Superfamily WWE domain 0.00288
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2XSL2
Sequence length 525
Comment (tr|H2XSL2|H2XSL2_CIOIN) deltex protein isoform X1 {ECO:0000313|RefSeq:XP_009860193.1} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=Ci-Deltex OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MNRDNIAIWEYLDEFWKMFSVKMCQNIEDGYQNYRQGSSANRLKLPRGSIDFKTMEYSSQ
QLIGPGTIRRVVLPGSSLLARNHTWQWKYKNAWENYTAEVNQLIEDHANWNKHQPLNLSQ
YDPTLMYIIYINDQKSGVQQNKNTGYQRKIRKERFSFKFPTTTDKVTSSLSNPATNSYTT
TPTHQQASSARQRRTASRNTHHSSQSSQHYYSNTPLYTIQPATAPSASYTTNSHHSSQSS
QHHYSNTLSYTTQPGTTPSYTTNSHHSNPRATSFQNIFSTDPYSSTTNTPALNAINSSSG
GKQGLLDKFSTTLTTPPSDDCVICMTSLSDVSGFQTSGATNQASSVIELKTCKHIFHAEC
LIASMQSGANDSFTCPCCKVIYGVKTGNQPPGQMHWSVIQTSVPGYEPHHTIRITYDIRA
GMQTNEHPNPGRRYSVHGFPRIAYLPDNTDGNKVLRLLEVAWNRKLIFTVGDSVTSGAKD
TVTWNEIHHKTSITNKHGHGYPDPNYLTNVLNELKAQGVSEDDLK
Download sequence
Identical sequences H2XSL2
ENSCINP00000032646 XP_009860193.1.78797 ENSCINP00000032172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]