SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2XYZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2XYZ5
Domain Number 1 Region: 36-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000458
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 80-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 119-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2XYZ5
Sequence length 147
Comment (tr|H2XYZ5|H2XYZ5_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000034879} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MDSEMKCSNTGPCISKSWACDGENDCRDGSDELPSICGNKTCNSDHFMCGNGILCIPNSW
VCDSDNDCGDNSDERNCTNTPCASGEISCTFTQQCVKKSAKCDGKYDCLDQSDELYCHVT
CNKDQFRCEKPPLCIPLSYKCDGVPHC
Download sequence
Identical sequences H2XYZ5
ENSCINP00000034879 ENSCINP00000034879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]