SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Y0B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Y0B6
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-33
Family Nuclear receptor ligand-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Y0B6
Sequence length 128
Comment (tr|H2Y0B6|H2Y0B6_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000035350} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
IVDQIVLLRGGCLEMLVLRSYFAFSCNENKYMSDKFQYKPSDFLQAGGNKEFVEKYNSLH
IRMRKMKLQVEEICLLLALVLFSPDRPGLEDQAKVEQMQDCVANTLQAYEYTHKPPNEVK
QCYFMYLK
Download sequence
Identical sequences H2Y0B6
7719.ENSCINP00000025480 ENSCINP00000035350 ENSCINP00000035350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]