SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Y0K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Y0K8
Domain Number 1 Region: 17-179
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.49e-31
Family CRAL/TRIO domain 0.0049
Further Details:      
 
Domain Number 2 Region: 256-381
Classification Level Classification E-value
Superfamily PapD-like 7.06e-24
Family MSP-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Y0K8
Sequence length 467
Comment (tr|H2Y0K8|H2Y0K8_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000035442} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
EVLYWRKEKEIYDISSDEFPLEMMKTGIVCCRGKANDNTRIVYFIVRKQTKDMKAKVQRM
ICLWLERIQRAEPGQHITFVMDVSKSSLANVDLGGIKFLLTCFTTYFPDMLEKILILEMP
WIMNTIWKVVKQWMTEDQRKRTIFSSFKDLNQYIDADNALTYMGGKDDWEYSFPPYPNES
PPIIMKQDSSSNFESDVISMAEGESKVGLDSTYSGAKKNKEVMKSDLSDPSKELPPSDEI
INLGSLLNYTTTLSYTLMSISPVAEVIFKQSTKDSNTSRYRSNITLTNRCKEEGMVVAFK
VKTNSPERYHVKPSTGSLSTGEELTIRIHLSPGYEDTVSRDRFLILYQKMEAGMDVAEFW
KDHIDKSSRFEHRIRVRFEATSTNLRLEPPVVLKNSIETTKISKSPNKSPIADEVAGLNR
ELARVKSQLGRAEESVEWIRSRFVYSLLLQSFLIVLLFLVIYKLSNI
Download sequence
Identical sequences H2Y0K8
ENSCINP00000035442 ENSCINP00000035442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]