SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Y1I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Y1I7
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000808
Family APC10-like 0.021
Further Details:      
 
Domain Number 2 Region: 366-386,429-640
Classification Level Classification E-value
Superfamily ARM repeat 0.000000785
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2Y1I7
Sequence length 855
Comment (tr|H2Y1I7|H2Y1I7_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000035771} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100187042 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MPSKIGYSVVGSTGEAEGYGAKNLEHQNPTIPGWQTPRFCVYPQELIIRMNERTNVKKLQ
LLAHQFMIPSKIEFFVGTNESADSFKRLGYIYLSNNEKTGFKARELKSVHVDADGHFLRL
VVHKNHMNKFNLYNQVGIMAFNVIGDGISKRHPLKPISSGTTNPLNYSIEGSINKPDYIS
PMDDLAFDMYQDPEVAGIIRKLDVKKQKAVIAENFDVAKRMKQAIADLQKVGEKLARYEL
DKRRAVEHEDYDLAKSKKSQMDEYRLKVYQQLQKYNLLEDAGISPVKQNGEQPLQQSPNQ
AHAGPQPSPPPMESPSLFVPHEEIASPRLEPPQEQKTFKTQIQEKVASPEPVATYSPRVR
HSPAIYDEKVIPALVKHKDPDPFLEDEFKNSCFSVAINKPSAPSGEPEAMSEKSIREASS
VIDVFGLPLVSGAYSKTWSFREDALLAVYKLLSNAPETISKDELKSHLRAAIFLIRRAIK
DKVHAVFHASLRLLELILVDFVPKHKLGKVETVHAVSRTLPNLIQKTGETAARSRNAAIE
FIDRMSEFAMVHQYQLVAQQATPPFKRDMAMRLALSRVEILERLFTKFGLEPPVLTVETG
MKFASQALSHSSGSVRDAATRIIFLLYKIAGNAVKAYLPPDDNTTRKNPLYRNIFDGFDR
ISGKLTQSELKAQQQAKAAESERKKKQEIEDLQSQVNQLRQMNNMVANEKSKKSTTKPPP
PPAEGSEASPNKAGDENDSTYLENMCIFCGERDDAFTEEGLDLHYWKHCPLLKKCEHCKQ
VVEVAGYCGHLLTECDKKSEFGECPRCKEAIPLTDLDKHVADKRCTAAKPGLDHCPLCHK
NIALGEESWKSHLMG
Download sequence
Identical sequences H2Y1I7
ENSCINP00000004377 ENSCINP00000035771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]