SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2YA68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2YA68
Domain Number 1 Region: 137-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2YA68
Sequence length 232
Comment (tr|H2YA68|H2YA68_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000002216} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MDTVPDSSENQNTNFTVVQSRKRKLKAANMETEDSKRPHFPSISGEKLLSGKSSFRKIPI
PSNRYTPLKENWMKIYTPIVENLRLQIRFNLKSRNVELQTSPETTDIGSLQRAADFVKAF
VLGFSVEDSLALVRLDELFLESFQVTDVKRLKGDHLSRAIGRVAGSGGRTKFTIENVTKT
RIVLADTHIHILGSYQNIRLARTAICNLILGSPPSKVYGNMRAVASRSVERF
Download sequence
Identical sequences H2YA68
ENSCSAVP00000002216 51511.ENSCSAVP00000002216 ENSCSAVP00000002216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]