SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2YV42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2YV42
Domain Number - Region: 15-117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0619
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2YV42
Sequence length 270
Comment (tr|H2YV42|H2YV42_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000009202} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MRDEIKNKNLEEKHALRIQLEGAVESLWKQFQAALKNYNETTEERKIAFENLKAKDEKSA
KEIETQMRKLQRIQDTINQLRAKMQQNSRECEDRNRRLREEREHVQTHFQQLKSEMNNNR
EADRAKLTQLTLQSNSAIKKLKKVCDKGEQILRLSEMCRKLETEEEKVLPFYASSLSQEE
QEDVEAAVYESPSEPLATIMHEYTSLDNFWKRYNKVLLDKLALDKEKQILSQENQQLRNV
LKQYLDGISVNDEILSQNNPLFVVNHKTNV
Download sequence
Identical sequences H2YV42
ENSCSAVP00000009202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]