SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2YVH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2YVH4
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000667
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2YVH4
Sequence length 70
Comment (tr|H2YVH4|H2YVH4_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000009334} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MQFSWKTDMVEAWIAEKERALKTDDNPTDLSSVQALIVKQETFDAGLAAFEQEGVAKITG
LKDQLVKADH
Download sequence
Identical sequences H2YVH4
ENSCSAVP00000009334 ENSCSAVP00000009334 51511.ENSCSAVP00000009334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]