SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Z8D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Z8D6
Domain Number 1 Region: 117-303
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000228
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2Z8D6
Sequence length 311
Comment (tr|H2Z8D6|H2Z8D6_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000013848} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MLLTNQCHDLITRSVQDYGDVLAPRMYFVSPTPLMQYPCQYGSFPNIDEGFVKYLEEAQF
SLGCFEPPAAPKLKIKQRKLVTARQKPYRKTSRSPEANEMEPTGMKSPILLRLLQSPDSE
SQTCQRKSDMNSNSTRLSSRIGHLSSENTFGFVEEILQKTEHFFESVPMLGDPSPQQRHG
FFLDYWAEVFIIFCAEKGIEIDAIEKSVRADLDSHCSKRDIHKLHDFVKRCQSMNLSSLE
YEYLRGAVLGIQDGFINTVVSPKSRSVRSSQISLNLLALRSVSSQRIADLFLRPVFGCSD
IEKIQSGSSFK
Download sequence
Identical sequences H2Z8D6
ENSCSAVP00000013848 ENSCSAVP00000013848 51511.ENSCSAVP00000013848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]