SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ZBG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZBG3
Domain Number 1 Region: 389-514
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-17
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2ZBG3
Sequence length 529
Comment (tr|H2ZBG3|H2ZBG3_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000014928} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MIDDLFDGVEFEESRSPSPFAPTLTRQKSKLEIKCELSVRKQTCNEAEDTHMVTRQPSRR
PLARSTSSESVVSLGAEKKATPFPISIDSYRTEKRKSLRKQSDNKKVVRNESVQSVAPPR
AATVKEKIGGMMEEIQQQQRVIQQASAALNCCYDAHHGKGSITELEAEKLLLIASEKRLA
LLAEVQALKSRSVTEPPQTVQPCLGNLTIRNLRLPLRTEYIFSMASKKDCGDIRSHYYFL
LVRCGPTRILASHLASTHDSLSGDSLVFSDEFKLVDLESNFDITIEVYSVTHRSRADGVP
NQEKSKRKLSGILHKSLTPRKLRSRSHMTMTHTSSPGGPNAIRISSFSLIGAVSINLNDV
KSEKFTLQKVPFLSPISGHFACKIEADFQSNVEQRGFLTMFDDVGGLGAWHRRWCALIRG
VLFSWTYPDDEKYKEALCKIDLTSCISERIRTVERIMCARPNTFELRTMRPRRHGDKDNL
ITQDTGSVITTKHWLAADTKDERIAWIESMNQALADVRAWDTNALKPLK
Download sequence
Identical sequences H2ZBG3
ENSCSAVP00000014928 ENSCSAVP00000014928 51511.ENSCSAVP00000014928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]