SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ZFH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZFH6
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000274
Further Details:      
 
Domain Number 2 Region: 206-301
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2ZFH6
Sequence length 504
Comment (tr|H2ZFH6|H2ZFH6_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000016342} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
NMSGPPVQRRHQPVQNVPSSLLSDNENRAVFTMLGRKCVTLATGVVQVYLANGAGTKWQK
RCTGVCCFVKDNPMRSYFIRVFSLKNEQTIWEQELYNQFKYNTPRSYFHTFDTEYCRAGL
NFANEAEANKFKQVVEEKIQQKHEKKREDAQNPNNSPQPHAPPEIKSAPVCSSMFHGTFV
DDGKKSKKGKKGKKGKLTKADISMPSGFKHVGHVGWDPNKGFDTDNMDPDVKELFKSAGV
TEDDMQDKEKAQFIYDFIEQRGGIDAIKKDQSRDRHAPPPPPPQRNGPPPPPQRNGPPPP
RRKETPRPAPPSHRNQPPPPPPDRSNRQPPPPQHRAAMAPPPPGQRMSQPPIPRGVPAPP
PPPSASAPPPPPPPMAPPPFAGGPPPPPPPLLSNAPPPPPMSGGGRGALLDQIRSGSAAD
RPVESAPSGGGGRGDLLAAIRSTGGIGALKSVSHEVEKPPPAQVEEDGLAGALARALMKR
ENAIHSDSDDDSNEDFDDEEEWSD
Download sequence
Identical sequences H2ZFH6
ENSCSAVP00000016342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]