SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ZT46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZT46
Domain Number 1 Region: 219-318
Classification Level Classification E-value
Superfamily TIMP-like 4.19e-17
Family Netrin-like domain (NTR/C345C module) 0.096
Further Details:      
 
Domain Number 2 Region: 44-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 107-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 3-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Laminin-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2ZT46
Sequence length 319
Comment (tr|H2ZT46|H2ZT46_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000000567} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
VHGRCVCKHNTAGDHCQHCAPLYNDEPWQPANGKTGMPNECKKCKCNEHADRCHFDMGTW
LASGNRSGGVCDNCQHNTEGQNCQRCKPGLYRDPQKPFSAPDVCKPCSCHPTGSTIFNIN
TYPYFLCDPSNGDCLCKPGVAGPHCDRCMVGYWGFGQYGCRPCDCAGSCDPLTGDCISRY
IDIFYADWKHSGMAFDTVHNESEPPQGWEDEQGFSAVRHSGKCECKEQILGHPKGFCGMK
YAYVLKAKILSAHDRGSYAEVNIKVKKVLKMTKLKVFRGKRKLYPESWTNRGCTCPILNP
GMEYLVAGHENVRTGRLIV
Download sequence
Identical sequences H2ZT46
ENSLACP00000000567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]