SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ZZE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZZE0
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-33
Family AlkB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2ZZE0
Sequence length 243
Comment (tr|H2ZZE0|H2ZZE0_LATCH) AlkB homolog 6 {ECO:0000313|Ensembl:ENSLACP00000002761} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=ALKBH6 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MVDSPSSLDHLESFRVEQAPPTVHYIPSFISESDEQLILQQVYSAPKPKWTQLSGRRLQN
WGGFPHPKGMVAEKLPDWLEKYTEKVSSLGVFGGKVANHVLINEYNPMEGIMPHEDGPLY
FPTVTTISLGSHALLDFYQPISKKEKTEQAVGDNESCPQMEENRYFLSLLLAPRSLLILQ
DDMYVQYLHGIKPVREDVVTEKIVNLGSCDVKPGDVLTRGTRVSLTIRHVPKVLKTTILL
GRR
Download sequence
Identical sequences H2ZZE0
ENSLACP00000002761 XP_005987841.1.90931 XP_005987842.1.90931 ENSLACP00000002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]