SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A0W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A0W7
Domain Number 1 Region: 52-208
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-31
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 800-905
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-18
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3A0W7
Sequence length 1052
Comment (tr|H3A0W7|H3A0W7_LATCH) Pleckstrin homology and RUN domain containing M2 {ECO:0000313|Ensembl:ENSLACP00000003288} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=PLEKHM2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
AAGILEPGAGDGARGCEGRDPTEGAAPAPVRTRRSRPTRARAKRVAAMEQLKVKDRILEN
ISLSVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDISSGYWVVVVHFTR
KEAIKQIEVLEHIATNMGRSRAWLYLALSENSLESYLRLFQENQSLLHKYYYENSLVCSH
DHLTLFLTLVSGLEFIRFDLDLDVPYLDLAPYMPDYYKPQHLLDFEDRLPSSMHGSDSLS
LNSFNSVTSTNLEWDDSAIAPSSEDGDLTDTTSCPRSATYEVQALNGHKASSRSPTLRYN
PFNYEKSEMVSSAETTPVHSAFPQKDEALDDASSYTDSYPELEVIRLAKKKKTSKKKRSK
PEEGLNNVNSSVEGKPLEDPEASVEQRVESPAAQEERTGLQDAGDMVDEDGNGQNKTGGE
TRLAEGGQHADSTQMGLLIPEMKDTSMESVGQPLSEVIDQLNGALDPAGWKLNREHPDQS
FRISPSGETPDGTLYRDFGEGFPAPMDFYRFTPESPSASAAGGGDNDPSGTGQSAHVPGG
SEAAVQAAESKAKTPGAVGDIPVVQCNGSIEAETPVAETGGDLLGSQTAVSTPNAKDSGI
EEGPNSPSEMIHPADFRVDNNLLLLLMIHVFRENEEQLYKMIRMSTGHMEGNMQLLYVLL
TDCYIYLLRKGAADKPYTVEDAVSYNELDYISVGVDHQTVMLVCTNRRRQFLLDTADKTL
TDFFFPNSLFKFASCSRWHQPPTHSLVVSSYRKTTSIAFWCFLQTACVCASDVTIHLYGL
IHWEDPMDVTMGPQSGIYRPAESAVTKEGVLYYKAGTSYLGKEHWKPCFVVLSTGFLYQY
PDQIDITPLLSINMASEQCGGCRRSNTTERPHSFQVILTDRPALELSAENEEEMADWMLY
LCQAVSKGVIPQGVVSTPCIPCCLVVTPRQMFTCHEDCQTSFFRSLGSAELANVTGVAAE
AGKEYCIVEFTEDHTQLLPPWVLYFSCTSELDRFLTVLATLWRNINQVELPRKPIQDPIS
QKKCEDALSLIHNAWQRSDSLHRGRSERDPWC
Download sequence
Identical sequences H3A0W7
ENSLACP00000003288 ENSLACP00000003288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]