SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A1R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A1R4
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.32e-26
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 87-372
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000265
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3A1R4
Sequence length 383
Comment (tr|H3A1R4|H3A1R4_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000003585} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
GLYCNRTFDMYACWPDGVPGMMVNVSCPSYLPWYEKVKHGTVSKKCGLDGLWVLLNSSRP
WRDYSQCEDEPEVTMEEEGTRRMMDSFKILYTVGYSLSLLALILALIILGTFRKLHCTRN
YIHANLFASFALRAVSVIAKDALLEKRWGMEIMDVTDWGILLSDEAAIGCRIAQVVMQYC
ILANHYWFLVEAVYLYKLLIGAVFSEKNYYTLYLYLGWGTPVMFVIPWMAAKYLKENTEC
WGLNENMAYWWIIRFPILMASLINLVIFMRILKVILSKLRANQKGYADYKLRLAKATLTL
IPLFGIHEVVFIFATDEQTTGTLRYIKVFFTLFLNSFQGFLVAVLYCFANKEVKYEIKKK
WQLWKLDNTPSCCSQLYSQVPLI
Download sequence
Identical sequences H3A1R4
ENSLACP00000003585 ENSLACP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]