SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A281 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A281
Domain Number 1 Region: 44-84
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000712
Family WW domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3A281
Sequence length 324
Comment (tr|H3A281|H3A281_LATCH) Yes associated protein 1 {ECO:0000313|Ensembl:ENSLACP00000003752} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=YAP1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
LCCLSVLLRLFSHIDQTTTWQDPRKALLPQMNVTAPTSPPVQQNIMSPSSGPLPDGWEQA
MTQEGEIYYINHKNKTTSWLDPRLDPRFGINQQRMSQSAPVKQAPPLAPPSPQSGVMGGS
NQQQQMRLQQLQMEKERLRLKHQELLRQVRPQFYPSSGSQKFCSELALRSQLPTMEQDGG
SQNPVSPPGMSQDVRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTIGQSNLASQQNRFPDYLETIPGTNVDLGTLEEDGMNVEGEELMPSLQEALST
DILNDMESVLAATKIDKETFLTWL
Download sequence
Identical sequences H3A281
ENSLACP00000003752 ENSLACP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]