SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3A5G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3A5G9
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.93e-23
Family Hormone receptor domain 0.00025
Further Details:      
 
Domain Number 2 Region: 79-257
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000011
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3A5G9
Sequence length 274
Comment (tr|H3A5G9|H3A5G9_LATCH) Vasoactive intestinal peptide receptor 1b {ECO:0000313|Ensembl:ENSLACP00000004890} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
PGCRGLWDNITCWPSAVVGEMVVKQCPIYFSYFANAHGNVSRMCTSHGWTELYPAPYAAA
CGYDTNSTPTEEKAVFFDVVRIGYTVGHSLSLISLTAAMIILCIFRKLHCTRNYIHMHLF
VSFIMRAVAVFVKDVVLFENGESDHCFVGSTGCKAAMIFFQYCIMANFFWLLVEGLYLHT
LLVISFFSERKYFWWYILIGWGAPLVFITAWTITRIHFENYGCWDIIESSFWWIIKAPIL
ISILVNFILFICIIRILVQKLHSPDVGRNDSSQY
Download sequence
Identical sequences H3A5G9
ENSLACP00000004890 ENSLACP00000004890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]