SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AC79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AC79
Domain Number 1 Region: 61-197
Classification Level Classification E-value
Superfamily PH domain-like 6.61e-23
Family Phosphotyrosine-binding domain (PTB) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3AC79
Sequence length 197
Comment (tr|H3AC79|H3AC79_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000007250} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
AARACFIARVPGSDLHMTKDKEEKDRGQKKKRRRRDSSMSFSNFHLVQTIKNSPAVIRRK
FSKDKTKSLSHGDPYFKVHYLGVEKIYSLQVEQTQEIVKSFLQSYQEKGCKDHALVVRPR
YLEVKEIVTGRQLTKTYLHDIAYCTADSVHPNIFLYICKRKGQLQCRVFLCNKAEKAKAI
TGCLAKSFERAFTDWQE
Download sequence
Identical sequences H3AC79
ENSLACP00000007250 ENSLACP00000007250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]