SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AD55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AD55
Domain Number 1 Region: 505-605
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-25
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Weak hits

Sequence:  H3AD55
Domain Number - Region: 76-168,505-525
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0136
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AD55
Sequence length 606
Comment (tr|H3AD55|H3AD55_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000007576} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
ESDASGLEEERRRVLSRISWEEKRITELQQQKEELMMEMEMEVALLEAELQMEREALQQE
EGLIVELKKRHADVELKHQADKEKSAEALEVAVKAFEDLEFQHLEKESSMEEERETLLRQ
ISSEIAEHQQTVARRKERVLKLKEEVTKMREQTEAQRRRLSEAKSESVKILNAEKGRLLG
LPARYSKETGAKSFPDTLQALGKIFLKFWEGVVTAALPAERSNFYCTPSSSQNLSPMKKG
RAQMLMDSEKLTGSAPCVLAATTLSILNSQKPLTFTPFSSLSPPPRAPLLKGTALVVCED
GRVEIVQMRTPTVQSPCMRMVRRIGLLGSSGKPPLAASFLLHEYHESRTRALPALQDFHF
YFVLSSSLSCRRELVATADTPPPTKHPPNKVSSHNGSPGPDIAEIERQLREAIAEKERLL
KDRRRLIELKRQAQRDAKRKELTPQQDKPVPSQAVELRHEERNTQEGPSAPHPAFSCVTF
DLKSHLDSLGHAVETCPHVTILGTSCKGFLTKMGGKIKTWKKRWFVFDGKKRRLAYYADK
EETKLKGVIYFQAIEEIYYDHLRSAFKSPNPKLTFCVKTYDRLFYMMAPTDVAMRIWMDV
IVTAAD
Download sequence
Identical sequences H3AD55
ENSLACP00000007576 ENSLACP00000007576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]