SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3ADH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3ADH1
Domain Number 1 Region: 28-228
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.08e-75
Family STAT DNA-binding domain 0.00000026
Further Details:      
 
Domain Number 2 Region: 787-997
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.16e-73
Family STAT DNA-binding domain 0.0000000281
Further Details:      
 
Domain Number 3 Region: 606-787
Classification Level Classification E-value
Superfamily STAT 1.41e-62
Family STAT 0.000000141
Further Details:      
 
Domain Number 4 Region: 469-590
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.75e-46
Family Transcription factor STAT-4 N-domain 0.0000127
Further Details:      
 
Domain Number 5 Region: 998-1139
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-42
Family SH2 domain 0.000000314
Further Details:      
 
Domain Number 6 Region: 229-345
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-40
Family SH2 domain 0.0000045
Further Details:      
 
Weak hits

Sequence:  H3ADH1
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily STAT 0.0922
Family STAT 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3ADH1
Sequence length 1179
Comment (tr|H3ADH1|H3ADH1_LATCH) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=STAT1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
VTYEGDPIPLQRPHLEERVKFLIYNLIRRLLVKLPELYYQLRVSATIDNHRKFNIIGTDN
KVMNLELSVNGSLSAEFRHLGTLGVTEELHSISFETNFSLHGLNIDLVTTSLPVVVISNV
CQLPNAWASVIWFNLLTNDPKNLAFFSSPPTASWSQLSEVLSWQFSSFGGRGLNSDQLIM
LAEKLYGQQLNCNDFQVSWAKFCKENCPGKSFSFWGWLDGILELIKKYLLPLWIDGYIMG
FVSKEKERALLKDKMAGTFLLRFSESNLGGITFTWVDRSENGDVKFHSVEPYTKERLYAL
PFADILRNYKVIVAENVPENPLKYLYPDIPKDKAFSKHYNSQPSEVLPVPISRGCLFFFF
KVQMLPPLHWTFSCHQFTGMPFSIYLTLQCQHTPIKQNTRDESPTLWFSCNAVPGEEEEE
WGGGVTSENCPVSKLLRLTCIVTNVGCLLCLKTAAVLVRTRTAAAEDFIMSQWYQLQQLD
SKFLEQVHQLYDDSFPMEIRQYLAQWLENQDWEHAAMNDSFATLRFHDLLSQLDDQYSRF
NQENNFLLQHNIRKSKRNLQDNFQEYPVQMAMIINNCLREERKILASAQMFEQKKQNQVG
NTQNTVMLDKQKEMDNKVKKVKNRVQEVEQDIKTLEDVQDEYDFKCKTLQSREHEPNGLK
PNELKQEQMVIRSMFITLDIKRKEVVGKMIDLLNVTEQTQDALINDELVDWKHRQQISCI
GGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKFTYEPDPITQQKQFLGERTHSL
FKQLIQRLLVKLQELNYQLRVKAQFDKDVNEKNTVKGCIHQLSVYICCLAHRFRKFNILG
TNSKVMNMEESTNGSLAAEFRHLQLKEQKNAGSRTNETTSLPLVVISNVSQLPSGWASIL
WYNMLTSEPKNLSFFLNPPAARWSQLSEVLSWQFSSVTKRGLNADQLSMLEEKLLGPNNC
SGDGLIPWTKFCKENIGEKSFSFWLWIEGILELIKRHLLSLWNDGCILGFVSKEKERALL
KDQRPGTFLLRFSESSRDGAITFTWVERSQNGNKPHFHAVEPYTKKELTAVAFPDIIRNY
KVMAAENIPENPLRYLYPEIPKDSAFGKYYARSKEPSEPMDVDDPKGSGYIKTELISVSE
VHPSRLQTTENLLPMSPEDFDEVTRIISPAEIDTVVGLL
Download sequence
Identical sequences H3ADH1
ENSLACP00000007692 ENSLACP00000007692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]