SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3ADY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3ADY8
Domain Number 1 Region: 275-451
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.92e-16
Family RNA methyltransferase FtsJ 0.032
Further Details:      
 
Weak hits

Sequence:  H3ADY8
Domain Number - Region: 757-788
Classification Level Classification E-value
Superfamily WW domain 0.000241
Family WW domain 0.0054
Further Details:      
 
Domain Number - Region: 594-723
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000683
Family mRNA capping enzyme 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3ADY8
Sequence length 839
Comment (tr|H3ADY8|H3ADY8_LATCH) Cap methyltransferase 1 {ECO:0000313|Ensembl:ENSLACP00000007859} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CMTR1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MKRRAEPEISETQKKQRKAIEDLGLNLSSTSDDDTQLSNHATQEKKCFLVGQEGTTCCAS
RDRFNFRECFLQQSYTLHGTLKMRFLCCLTFPAVKAKMGFREGEGLGKFGQGRKEIVEAS
QQRGRRGLGLTLKGFDGELNVSWQDEPQEKSTFPTFTWLFIHCSGVIYNIMRVSVRMCVF
QRKMVIEDETEFCGEDLLHTMLNCKNVFDELEGEEMRRARTRSNPYETIRGVFFLNRAAM
KMANMDFVFDFMFTNPKDSHGKPLVKERDAELLYFADVCAGPGGFSEYVLWRRKWHAKGF
GMTLKGPNDFKLEDFYSAPSELFEPYYGEGGIDGDGDITRPENLTAFRNFVMENTDRKGV
HFLMADGGFSVEGQENLQEILSKQLLLCQFLAGLSLVRTGGHFVCKTFDLFTPFSVGLTY
LLYCCFERISLFKPVTSRPANSERYVVCRGLKCGTEAVRDYLFTINLRLNQLRNSESDVN
EVVPLDVIRGDSEFYEHMIRSNEGYCAHQIKALAKIHAFVRDSTLCEARQADIRKECLKL
WGIPDQARVAPSSVDCKFKFFELIQGTDVDTFSYKPTILNSKILDKIRNVLDYRCMVAAG
EQCFLLGMGRSQIYKWDGRQPVRWEKLDTFKTELPRETLLSVELVQELKGEGRAQRKIFS
IHILDALVLNGTDIREQHFNQRIQLAEKFVKAVSKQSRPDMNPIRVKEVYRLEEMGKIFV
RLEMKITKGSSGMPRLSYTGRDDRHFLPTGLCIIKTVNDPWTMACSKSSKRKFFYNKATG
ESTYELPADSIAPFHICHFERLFWLWEEGVRVHDSQTKQDPEKLSKDDVLAFIQTHYQP
Download sequence
Identical sequences H3ADY8
ENSLACP00000007859 ENSLACP00000007859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]