SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AG38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AG38
Domain Number 1 Region: 120-250
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000144
Family Pentapeptide repeats 0.027
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000137
Family Pentapeptide repeats 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AG38
Sequence length 257
Comment (tr|H3AG38|H3AG38_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000008609} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=LOC106702506 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
LLYNTRMYNTLLYITQMYNTMLYNTLLYNTLMYNTLLYNTLLYNTQMYNMLLYITQMYNM
LLYITQMYNTMLYNILLYNTPMYNTLLYNTLMYNTLLCNTVLCNTQMYNTLTYNTLTYNT
LLYNILLYSTWTYNTLLYNTMMYNTLMYNTLLYNTLPYNTMLYNTLLYNTQMYNTLTYNT
LMYNTLLYNILLYSTQTYNTLLYNTRMYNTLTYNTPLYNTQTYNTPLYNTWTYNTPLYNT
RMYGTMLYNTLMYNILM
Download sequence
Identical sequences H3AG38
ENSLACP00000008609 ENSLACP00000008609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]