SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AIM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AIM2
Domain Number 1 Region: 1444-1508
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000748
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1013-1149
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000051
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3AIM2
Sequence length 1512
Comment (tr|H3AIM2|H3AIM2_LATCH) RUN and SH3 domain containing 2 {ECO:0000313|Ensembl:ENSLACP00000009493} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=RUSC2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MDSPPKLAGETLIVHHIPLVHCQVSDRQCRGGVGKRANPFSQTDLGITRTTSLPERDLSQ
KDSLVYSSLVQSFCPAVAAAAPEDTTEKQKEPKGPAGIKRHNPFILGESQDFDLKAAEGS
SQASFHLHSNSYLSKPAFHLHDLASNSFHLHEVTNKVKQWSLASRPGVVEGQEASGASDN
SAKTVGAQQPRLPVSEECMELALCNCRLDSVSTLSIECGDQEWSTSPDESMKNQDDGIIN
NTSRTCSCSSLELHQGRCCSLSDQSEVVDHQMGYISDSSCNSSDGVLVNFSALYNKMNDG
QTKSNLNLANSSCDSSFCSHSEATGAFYLDLHSSPINEPKSPSCISHHLESPGKICGCGQ
GSSPTLDANCNSYHCPSESSDLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSI
TSCSEEQTKSSPGQPTEYYLFRRPEGKQESGNKAESTTRKDPQAATTGNVIEGQVYVNVS
PPNATTGRQRSRSYDRSLDKSPPPRLGSLERMLSCPVKLSEGQSGDSGRSPPKRVTSFAE
LARCRRKSGFSPPLRSSGDSSLEFSPIPELHRADPVFPEDAGNRCHSLPPMPFAHCLGFL
QHHPAPPWWCSGQQGLRAEITPALASQAARKALLHLIFLYGTLAAENARSLAHSLTHGRT
DGRTDGRGGSDDEAVFRYSKDRRPTTLPIRPFILQHSFSKQLPKPSQPNSCTSLSSTSTT
STGQTPSAAAKPAAKRNNPAGGRASAQESAKKPGPSAMRPSPLGSYSPIRSNTPFLQGTD
TSSRTPTPDRASACQPPRSHSCPLSASLLPVRPSPARDVALPGTARLEPARGEAARQEKE
TPKPTGKREHSSLPTLPSDGPTANSTSSHSEQQQRRNSAESAKPGLASSLASRSANDPVR
RLIPIGVYFQSTTLPSHIPPQPIGQSVKQLQVYYSDFFPDYFSLAEKPPAEFCLSPDANT
ESISVDLLQKKELYPCISVCLSLQCAYLGQEKNLLFKAKLGNSSVSPNVGHLILKYLCPA
IRDILGDGLKAYVLDMIIGQRRNVPWSVVEASTQLGPSTKLLHSLVCKISQYAELTNHSM
RFNAFIFGLLNIRSLEFWFNHLYTHEDIVSVHYQPSGFLALAHSVCQPLFEELLLLLQPL
SLLPFDLDLLFEHHLAEMGREQRHKKEQLRVKQDLLQSAHSTFQLMRARGGGGGSLGEQP
ASVSCERMKAVGASAGEGENRSGLGEDRMVTAAKEQRVADLRKDKQSGWWYQLMQSSQVY
IEGTAEGPKFVKWEKRKKQGVMGARMESGRKEVRSVPPRPPREGVVEGAEDCPEPEKPRG
VEKCRLSWMGSPPESVLSELKNGAEKESGTVQRWTGWQQERAGDEPADGGQGLRWGHLFG
AGVRPGRRAPADTGLDKMPKNRLPSGWLNLDKSVLQRVAQTVGGGRRRQAQADQEDLKKK
KKKTMKASPMWKGEVKALCHHIATEEGQLSFNKGDVLRIVSKVDPDWLLCSVGSERGLVP
IMYVTHPEDKDY
Download sequence
Identical sequences H3AIM2
ENSLACP00000009493 ENSLACP00000009493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]