SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AJ33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AJ33
Domain Number 1 Region: 42-221
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.83e-18
Family AlkB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3AJ33
Sequence length 231
Comment (tr|H3AJ33|H3AJ33_LATCH) AlkB homolog 7 {ECO:0000313|Ensembl:ENSLACP00000009654} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=ALKBH7 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
VDLLQTWLCRTMSPVISPLLILKLKGPFPPNGQLLAGSNSAVLQYLAGSVEVRERFISEE
EEGILLQEIEPTLKRKRYEYDHWDDAIHGYRETEKSQWTERNKAILQRVRDVAFPPGVPQ
LALVHVLDLDKKGYIKPHVDSVKFCGNTIAGLCLLSSSVMRLVSENDACDWVDLLLRRRS
LYILRGRARYEFTHAILREEESVFNGEKVPRNRRISVICRNLPVHESQAVQ
Download sequence
Identical sequences H3AJ33
ENSLACP00000009654 ENSLACP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]