SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3ANR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3ANR6
Domain Number 1 Region: 339-468
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-25
Family Ran-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3ANR6
Sequence length 469
Comment (tr|H3ANR6|H3ANR6_LATCH) Nucleoporin 50 {ECO:0000313|Ensembl:ENSLACP00000011287} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=NUP50 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MPKRIADKELTDRNWFQEDEVEEAGTFSVASEDVLKSRTIKKAKRGNVGAEAENSSAFKG
FKGLVVPSGSKTGFSGFGNGFGLKSLQGVSNGNGGSSGPSPFTGFKASESNIGVFGSDSS
ALGFFQKKDAATKLNGKNEASHSSSTPPLSRTCGNSTEYNKQLTALNCSVRDWIQKHVNE
NPLCDLTPIFRDYEKHLASIEQKYGSSSDSGSESDTSGKKIETPSALTLGALPQQVPAAS
TPLFSFTSKKESIPDKMAKLSRTASEFAGGIGKKGNSGLRSLGSGAVPSFSFSSGGSSSL
FGKDPNQVKPVATSFSFTSSESKPKGETQEETKGDPEDKDEESEEPPKNVVNEIKEDDAF
YSKKCKLFYKKDNEFKEKGVGMLHLKPVDKKTQLLVRADTNLGNILLNIFVQPSMPCTRT
GKNNILIVCVPNPAVDEKNPTIPVPVLIRVKTSDDADELHKILLEKKEA
Download sequence
Identical sequences H3ANR6
ENSLACP00000011287 XP_005993728.1.90931 XP_014342537.1.90931 XP_014342538.1.90931 XP_014342539.1.90931 ENSLACP00000011287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]