SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3APN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3APN2
Domain Number 1 Region: 8-390
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-98
Family Ras GEF 0.00054
Further Details:      
 
Domain Number 2 Region: 452-520
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 384-456
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000045
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  H3APN2
Domain Number - Region: 669-708
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0144
Family Moesin tail domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3APN2
Sequence length 719
Comment (tr|H3APN2|H3APN2_LATCH) RAS guanyl releasing protein 1 {ECO:0000313|Ensembl:ENSLACP00000011603} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=RASGRP1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
DADGNLCRSNHLLQVVLTMHRFIISSSDLLQKLIKLYTNALEKNSIGVCQRICYLVRYWT
TEYWVMFKMDSSLTEAMEHFQELVRRNGDESHCCLIDTTQINARDWSRKITQRIKPNSSK
KRKVSLLFDHLEPDELAEHLTYLEFKSFRRISFSDYQNYVVNGCVKDNPTMERSIALCNG
ISQWVQLMVLNKPTPQLRAEVFTKFIFVAQKLHQLQNFNTLMAVVGGLCHSSISRLKETS
SYVSNEVHKVLNEMTELLSSCRNYDSYRRTYSECSSFKIPILGVHLKDLISVYEAMADYL
EDKKINVHKLQVLFNHINELIQLQQVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAR
EPRNNRVPPATPSKPPVVADWASGVAPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQD
EFEKIAASFPFSFCIMDKDREGLISRDEITAYFMRASSIYSKSGLGFPHSFQETTYLKPT
FCDNCAGFLWGVIKQGYRCRDCGMNCHKQCKDLVVFECKKKLKSTLVDNSPMPGSTPSAL
CPAGVKGQSQGADEGPFMFPNGEMANEHTEESKDRTIVLMGGSAQKISLRLKPTVVHKST
QTDTEISNGSTPTGLFPLASPRSKASDSVLLIPSPTSPCPSPVLVRKRAYAKWENRASTF
KPREEQNCKPTLHQIEKENSNLREENEALQRKLKEAQREIEALRIKLQRFENKEQRDSP
Download sequence
Identical sequences H3APN2
ENSLACP00000011603 ENSLACP00000011603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]