SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3ARW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3ARW3
Domain Number 1 Region: 50-266
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.36e-33
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3ARW3
Sequence length 268
Comment (tr|H3ARW3|H3ARW3_LATCH) Jumonji domain containing 8 {ECO:0000313|Ensembl:ENSLACP00000012384} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=JMJD8 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MGHWRLAVLLATLFTLANLQEEEEEDGGWLTSRYIALTGEGPCNVEVKNSTLTYSEFIQK
FAFSRPVVIRGITNNSEFQRLCSKRHLLEQHGDQMVRLSTANTYSYQKVDVPFREYVDHL
LKPQSMETLGSDTLYFFGDNNFTEWGPLFQKYIAPPYGLPGTSEAYSFGIAGAGTGVPFH
WHGPGYSEVIYGRKPFKRWFLYPPDKAPEFHPNKTTLSWALDTYPILSEEDKPIECTIHP
GEVLYFPDRWWHATLNLDTSVFISTFLG
Download sequence
Identical sequences H3ARW3
ENSLACP00000012384 ENSLACP00000012384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]