SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3ASZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3ASZ5
Domain Number - Region: 12-80
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000107
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Domain Number - Region: 74-198
Classification Level Classification E-value
Superfamily RUN domain-like 0.00353
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3ASZ5
Sequence length 204
Comment (tr|H3ASZ5|H3ASZ5_LATCH) Mediator complex subunit 29 {ECO:0000313|Ensembl:ENSLACP00000012766} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=MED29 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MAASALQAAQQQQPQPQPQPQPQPQPQPSQPPSALPGQAAAQSQLQGAALQQQQQQQQQQ
DFDPVHRFKMLIPQLKESLQNVMKIAAQNLVQNTNIDNGQKASDATVQRFDKSLEEFYAL
CDQLELCLRLSYECLSQSFDSAKHSPNLVPTATKPDTVQTESLSYTQYLSMIKSQISSAK
DIHNALLECSNKITGKGQTQGILG
Download sequence
Identical sequences H3ASZ5
ENSLACP00000012766 ENSLACP00000012766 XP_005987863.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]