SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AVD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AVD2
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily RUN domain-like 3.53e-30
Family RUN domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AVD2
Sequence length 393
Comment (tr|H3AVD2|H3AVD2_LATCH) RUN domain containing 3B {ECO:0000313|Ensembl:ENSLACP00000013603} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=RUNDC3B OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
QIETFCLLAHHTLFISGQITWFGYESPRSFWDYIRIACSKVPHNCISSIENLEHISYFKK
KGRAWIRVALMEKRLSEYISTALRENKITRRFYEDGAILMGEAANMVAGMLLGLNAIDFS
FCLKGEGLDGNFPAVIDYTPYLKFTQSSDSISSDEEELRTLGSSGSEGSTPENIGPPFVM
DENSWYNKCKRIEQKYRLALEQKGYLEELVRLREAQLSESATQNKLLLQRIDEANLSHNL
ERDQLEYIILELQDQLTIVKNNDQRSRQELTTHLTNQWPSPGALDANAVALDTLLYRKQN
GQWDEKSFQSLEQLSAEMSLSQTSLDPAHSQEGDSKLEGSTLQSGGKEDTPSLLGLCGSL
TSVASYKSLTSLKSSECLASPTTEMTSPGLTPS
Download sequence
Identical sequences H3AVD2
ENSLACP00000013603 ENSLACP00000013603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]