SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AW54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AW54
Domain Number 1 Region: 47-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000811
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 110-161
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000222
Family Hairy Orange domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3AW54
Sequence length 346
Comment (tr|H3AW54|H3AW54_LATCH) Hes related family bHLH transcription factor with YRPW motif-like {ECO:0000313|Ensembl:ENSLACP00000013875} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=HEYL OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MKRPCEESSSDSDLEETIDVGKEEDYSYFSPVSRSLSPTISSQILARKKRRGIIEKRRRD
RINNSLSELRRLVPTAFQKQGSSKLEKAEILQMTVDHLKMLHATGGKGYFDAYALAVDYR
SMGFRECLAEVARYLSSLDGLDKGDPLRVRLVSHLNSYASEMEPLQAAPSVLSFHSWPWS
YAHISNLFPRAALFATSALAYPTPTLRTPSVGRAPTTVMPPNQNHLSNLTSSRVLSNLRS
PVCRVLSTGIPPMPGSLSSMTSSSNTVTSSNNILSNVRSPSNSMASSLLPPPPVSVALHA
AAGAQNPSALGPFVNLSPSTLYQPPHLNNSSPTQPYRSWSTEIGAF
Download sequence
Identical sequences H3AW54
ENSLACP00000013875 ENSLACP00000013875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]