SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AXT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AXT9
Domain Number 1 Region: 100-265
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-49
Family RUN domain 0.00000015
Further Details:      
 
Domain Number 2 Region: 556-594,635-697
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  H3AXT9
Domain Number - Region: 329-432,472-524
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0175
Family DNA repair protein MutS, domain III 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AXT9
Sequence length 702
Comment (tr|H3AXT9|H3AXT9_LATCH) RUN and FYVE domain containing 2 {ECO:0000313|Ensembl:ENSLACP00000014460} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MASSAEQDLTLAEGESNKKEQSFGILRLQEEKAGESRSASRGGGGGVGDGRWQAPIFALA
RKASETISGSIPALPKASPAVAASTEHEEWDRKAIKDPMAVERANLLNMAKLSIKGLIES
ALRFGRTLDSDYPPLQQFFVVMEHCLKHGLKVKKSFLGYSKSIWAPMELVEKLCPEAGEI
AASVRDLPGLKTPLGRVRAWLRLALMQKKLADYLRCLITRKDLLSDFYDYHALMMEEEGA
VIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSLYLRNEEDSYRSEERNGQIAAILDQKN
YVEELNRQLNSTVTSLQARVDSLEKSNTKLIEELAIAKNSIIKLQEENHQLRNENTLILM
RTQHQLETAKVDVDAELDTYKQSRQGLDEMYNEARKQLREESQLRQQKTIDAYLVWDLSI
NKENIVFLQNTVKDIHYNTIITHQQSQGIVAIRVVQVQETQGSEDGLSQKNEIISRLEEK
TNQITATMKQLEQRLQQAEKGRQAAEDGVRKFKQEFTSKSDSLQKQILKREKQLLQLETD
WKIEKEWRQTLQNDLDREREIISELKTETEQMNGLKKEFLRLQEENTQLKRICEEQEQAL
QELGFKLSESKLKIEDIKEANKVLQGGGGGQGWLKDKDATHCKLCEKEFSLSRRKHHCRN
CGEIFCNACSDNELPLPSSPKPVRVCDTCHAMLLQRCSSNST
Download sequence
Identical sequences H3AXT9
ENSLACP00000014460 ENSLACP00000014460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]