SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AYU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AYU5
Domain Number 1 Region: 114-385
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.29e-57
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.048
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.04e-18
Family PHD domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3AYU5
Sequence length 992
Comment (tr|H3AYU5|H3AYU5_LATCH) PHD finger protein 8 {ECO:0000313|Ensembl:ENSLACP00000014816} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=PHF8 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
KMASVPVYCLCRLPYDVTRFMIECDVCQDWFHGSCVGVEEEKAAEIDLYHCPNCEIGHGP
SVMKRRRGSQKPEIPVNRDGGRPVQTGSALFIKELRSRTFPGAEEVVLKPTGTQLTVEYL
EENSFSVPILVAKKDGLGMTIPSSSFTINDVEYHIGADRVIDVIDVTRQADCKMKLGDFV
KFYNSPNRDKVLNVISLEFSETRLSNLVETPKIVRKLSWVENLWPEESVFERPNVQKYCL
MGVKDSYTDFHIDFGGTSVWYHVLRGEKIFYLIRPTGANLALFECWNSSSNQNEMFFGDQ
VDKCYKCPVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTA
DLFKFPNFETICWYVGKHLLDTFRGLRENRRHPAAYLVHGAKALNMAFRAWTKKEALSEH
EDEIPETIRTTQLIKDLAKEIRLVEDIFQQNKGKTGGPFGLQRNPPASKVPAVNTSPAAK
PGRKRGPKPKEMGKKRGRKSKESLAAEAAAKNMSMKLVGGRSKQAPKKTTLPKKEKYKTP
SAYLKELDGELSLDSGLDEGKVRLVLSNGKILRCVRQGETVFHPLVGGLEKAMGLGRKEE
FDYDSEDDLQIDEAPLKKASVIALTVLAFPEFPRKLPRAKPCSDPNKIREPGEVEFDIEE
DYTTDEDIPDILDEKLRGANSTGGILDLLKASKQVGGLDYIALNEPPASPSTQEAIQGML
CMANLQSSSSSSPVVTSLQAWWASNQERNSGATSGSTSLSSKVIQRPGKRAIKRPAKEGF
ESEGEESVDEQESLGACFKDSDYIYPSLESDEDDPALKSRPKKRRTSDDAPWNPKARVTP
SLPKQDRPVREGTRVASVETGLAAAAAKLAQQEHHKTQKRKYTKKKQSAKDGGKVSQDGD
TGAADPESKVEAFAGSLADHEYTAGPNIFGMVQVNRGTTPMAPGVFLSQRRPQTSSLSGT
PGQSKRPKKGLATAKQRLGKILKIHRNGKLLL
Download sequence
Identical sequences H3AYU5
ENSLACP00000014816 ENSLACP00000014816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]