SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3AZB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AZB3
Domain Number 1 Region: 111-269
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-23
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 358-446
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-19
Family Pleckstrin-homology domain (PH domain) 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AZB3
Sequence length 799
Comment (tr|H3AZB3|H3AZB3_LATCH) Actin filament associated protein 1 like 2 {ECO:0000313|Ensembl:ENSLACP00000014984} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=AFAP1L2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
AVGQLLAELEEFLKILDRENLSSTALERKCLLSDLLQTYTKSNGCDEEYIYMNKVIFIKQ
QQGQEKPSSDGVPDHIYCLTNGDLGKHSPAPQKSLPDLPLPRIVKNIDRQQCPLPKTESP
DGYYEEAEPYSTTTFDDGEAVSSSYESYDEEESSKGKCTTHQWPSTEASIELMKDARICA
FLWRKKWLGQWAKQLCVIKDNRLLCYKSSKEQHAQLDVNLVGCSVVYKEKQMKKKEHKLK
ITPVNADDIVLGMQSKEQTEQWLKVIQEMSNIHPESISDGTQATQDTSRQSCTKTDLSER
GSAASESGSSTDGHSESIDTKDVKKKSSTGLKLSTLMNLGRKKSSFLESPERTLLEPSGY
LNVLVNSQWRSRWCQLKEGRLYFYQDKSKTKMIQQTVALEGCDIISDPSPEHLYSFRILH
SEEEVAKLEAKSSDEMGHWLGLLLSESGSKTTPEELVYDYVDADRISSIVNAARTSLYLM
QRKRSEPNTYIDSLPVAQNQSDDLYDDVDVSDQVVRFHEENLKEEVKPKEAEDRIYLDLI
PAKSLFSNDKQSSTTPSSSPLLQRSSTNPVEETSTKDTNVGLEQEPLFQHTLDTEDFIPK
TVIKIQTHQQKITFPQGDFNKKTPTNNPQPYKDYLSTSLIEAKLGKSRTEADIKIFSEEK
ERLEKEKENIRQELAQLRKEKREVKEAISTCTEKSTLSLLEEKLKQIDEDCKQKENIRVD
LELELVEAKENLKKAESGPVMLGTTVEAFHFETPTSNVKATSLISSPETSPAVNSATALK
NRPVSIMVAGKGTVLQKAK
Download sequence
Identical sequences H3AZB3
ENSLACP00000014984 ENSLACP00000014984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]