SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B0G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B0G0
Domain Number 1 Region: 695-825
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000205
Family Synaptotagmin-like (S variant) 0.008
Further Details:      
 
Domain Number 2 Region: 6-41
Classification Level Classification E-value
Superfamily WW domain 0.00000000000282
Family WW domain 0.001
Further Details:      
 
Domain Number 3 Region: 56-90
Classification Level Classification E-value
Superfamily WW domain 0.000000000236
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3B0G0
Sequence length 1138
Comment (tr|H3B0G0|H3B0G0_LATCH) WW and C2 domain containing 2 {ECO:0000313|Ensembl:ENSLACP00000015381} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=WWC2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MPRKGNGQLPLPDGWEEARDYDGKVFYIDHNTKQTSWIDPRDRLTKPLSFADCVGDELPW
GWEAAYDPQIGVYYIDHINKTTQIEDPRKQWRKEQERMLKDYLMVAQDALSTQRELYQVK
EQRLALALDEYVRLNDAYKEKSSSRTSLFSGSSSSTKYDPDLLKAEISTTKVRVNKLKRE
LSQMKQELLYKEQGFETLQRIDQKMSGGQSGYELNEAKAILNELKSIRKAISSGEREKQD
LMQSLAKLKERFHFDQSIEIPEPDLRSSAANSHLSLSRHTLDAGSQTDISGDIGMRSRSN
LAEKVRLSLQYEEAKRSMANLKIELAKLDGETWPGALDAEKEKLMLINEKEELLKELQFV
TPRKRTKDELELLDAERKKLEEDILAVKSTPSQALAERLKLQEKRKDLMRKLEETTRLTT
FLHTQLKSLSASTLSVSSGSSLGSLASSRGSLNTSSRGSLNSLSSTDLYYSQADQTTDLD
YQYKLDFMLQDKSGYIPSGPITTIHENEVVKSHSSLRYTDSSESAAAGQATKSSEPPKSV
TSLSSRSSLSSLSPPGSPLVLEGAFSVSVQDSALHRLSTDFEDCELPADFAGLGLYENQI
LLDSDSGAAQFLAEDKELNEGLRRPLSTLQEGIADVSLQRTSGPLLAVKTACVSAAVSDE
SVAGDSGVYEASVKRPDEAEDVVCSEDEVSVWEAAQVQLGLKYDTSHSSFIIIIMQLRSL
HAFILSHSCKVYVRVAVLPSLCDTSCLFRTKLHPAAETMVYNDIFRVTISQAALQQKTLR
VDVCTVGGTHREECLAGTQISLADLSLSGEMCTHWYNLLPCKKFPSQNNKEHNEETVLPP
SQQPSSTVDLDAVSALLERTSAELEAVEQELAQEEEQAAVEEDWLEMLVEDSAEVVEEDD
EEEELEEEEEEGGCKMTEEEEEEYTEGMDLYPEVVVMEGKPADENSTLTGEAGPLPEAVA
PALVDKETNTEETVTENMAVRPKDRNSLNSRQRPFVRNSMIVRSQTFSPGERNQYICRLN
RSDSDSSTLAKKSPFVRNATERRSLRVKRPICQPMVRRPAQEHPVRTSLDLELDLQASRT
RQSRLNDELQALRDLRQRLEEIKARGKTELPQCVLEDERFQKLLKQAEKQVRRATVTE
Download sequence
Identical sequences H3B0G0
ENSLACP00000015381 ENSLACP00000015381 XP_005989542.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]