SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B145 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B145
Domain Number 1 Region: 213-280
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-19
Family Homeodomain 0.003
Further Details:      
 
Domain Number 2 Region: 34-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000122
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 4-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000165
Family LIM domain 0.0067
Further Details:      
 
Weak hits

Sequence:  H3B145
Domain Number - Region: 96-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00773
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3B145
Sequence length 320
Comment (tr|H3B145|H3B145_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000015616} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN= OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
AAEKVVRCAGCRGRIFDRYFLFVMDKQWHSRCLRCCVCQAALESEITCFCKDGEIYCKDD
YYRRFSVKRCARCHMGILASEMVMRAREAVYHLSCFTCASCGRALLTGDLYGMAGGRVYC
RQHYQCEGAEQPHGEEEMEEEEEEAVAAGMEGQAESRDKAEGGSVLPGALGVERAPPKRR
SRKRKEHGVRNDGGIFNSDTVCMENISIYIDRQRHCQTDRQKVKRIRTCFKNHQLQTLES
YFTLKHNPDGKDWEQLSKKTGLPKRVLQVWFQNARAKLRKNVSQDENTDTDSVPEVSEQS
ASPPANPPLDAFSPALKSPS
Download sequence
Identical sequences H3B145
ENSLACP00000015616 ENSLACP00000015616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]