SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B3W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B3W2
Domain Number 1 Region: 27-203
Classification Level Classification E-value
Superfamily TIMP-like 3.53e-51
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3B3W2
Sequence length 216
Comment (tr|H3B3W2|H3B3W2_LATCH) TIMP metallopeptidase inhibitor 3 {ECO:0000313|Ensembl:ENSLACP00000016583} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=TIMP3 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MSLFVSVFFSLLLALSSWNLSQFVEACTCVPNHPQDAFCNSDIVIRAKVVGKKLMKDGPF
GTMRYTIKQTKMYKGFNKVSHVQFIYTEASESLCGVKLEVNKYQYLITGRVYGGKVYTGQ
ILFFFAARMTNKVSSGRPSSNLAYTLSCSTKIKPCYYLPCLVTSKNECLWTDMITNFGHP
GHQSKHYACIQQKEGYCSWYRGWAPPDKTSINTTDP
Download sequence
Identical sequences H3B3W2
ENSLACP00000016583 ENSLACP00000016583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]