SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B5Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B5Q1
Domain Number 1 Region: 185-424
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-72
Family Nuclear receptor ligand-binding domain 0.00000000494
Further Details:      
 
Domain Number 2 Region: 65-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3B5Q1
Sequence length 426
Comment (tr|H3B5Q1|H3B5Q1_LATCH) Nuclear receptor subfamily 1 group H member 2 {ECO:0000313|Ensembl:ENSLACP00000017222} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=NR1H2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MGGLLQDPSNQEVMLSSVKEEPGRDPSPALQDGVSSPEGEESPAIDPEALPLKRKKGPAP
KMLGNEMCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKDARYSCKNDGKCQMDTYMRRKC
QECRLRKCRQAGMREQCVLSEEQIQRKKMRKQEEETVRASVITQHAPSVLPDPIGTGAMA
AATPLTTEQEKMIQQLVAAQQQCNKRSFSDQPKVTPWPAASDPHSREERQQRFAHFTELA
IISVQEIVDFAKQIPGFLDLSREDQIALLKASTIEIMLLETARRYNDENDCITFLKDFTY
SKEDFQRAGLQVEFINPIFEFSKGMRLLQLDDAEYALLIAINIFSADRPNVQDQELVERL
QLPYVEALHSYTLIKRPQDHLMFPRMLMKLVSLRTLSNAHSEQVFALRLQDKKLPPLLSE
IWDVHE
Download sequence
Identical sequences H3B5Q1
XP_005990993.1.90931 ENSLACP00000017222 ENSLACP00000017222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]