SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B816 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B816
Domain Number 1 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000431
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 56-91
Classification Level Classification E-value
Superfamily WW domain 0.0000000000344
Family WW domain 0.0019
Further Details:      
 
Weak hits

Sequence:  H3B816
Domain Number - Region: 120-136
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00402
Family Tyrosine-dependent oxidoreductases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3B816
Sequence length 141
Comment (tr|H3B816|H3B816_LATCH) WW domain containing oxidoreductase {ECO:0000313|Ensembl:ENSLACP00000018037} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=WWOX OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MAALKYAGLDDTDSEDELPPGWEERTTKDGWVYYANHVDQKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQLFFVDHINKRTTYLDPRLAFTVEDNPVKPNIRQRYDGNSTAMEILQGR
DLTGKVAIVTGANSGIDFCWA
Download sequence
Identical sequences H3B816
ENSLACP00000018037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]