SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3B859 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B859
Domain Number 1 Region: 55-181
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.2e-67
Family RUNT domain 0.000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3B859
Sequence length 191
Comment (tr|H3B859|H3B859_LATCH) Runt related transcription factor 1 {ECO:0000313|Ensembl:ENSLACP00000018080} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=RUNX1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
FVVMRIPVDTVTSRRFTPPSTTLSPGKMSEVLPLAGQDSSAALAGKLRTTDRNMVEVLAD
HPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAEL
RNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTSLPQVATYHRAIKITVDGPREPR
SKYLWPGYHHR
Download sequence
Identical sequences H3B859
ENSLACP00000018080 ENSLACP00000018080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]