SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BAR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BAR2
Domain Number 1 Region: 225-420
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000199
Further Details:      
 
Domain Number 2 Region: 10-112
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-25
Family SH2 domain 0.00000157
Further Details:      
 
Domain Number 3 Region: 156-220
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.27e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BAR2
Sequence length 420
Comment (tr|H3BAR2|H3BAR2_LATCH) Chimerin 2 {ECO:0000313|Ensembl:ENSLACP00000018983} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CHN2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
VENRPKYYGREFHGMISREQADEQLAGAEGAYLIRESQRQPNCYTLALRFGNQTLNYRLF
YDGKHFVGEKRFESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATMLREKVSR
RLSRTKQDSRKACVTNEENNSIEKITSLVRRAALKQNENHFNYEKAHNFKVHTFRGPHWC
EYCANFMWGLIAQGVRCSDCGLNVHKQCSKFVPNDCQPDLKRIKKVYSCDLTTLVKAHNT
QRPMVVDMCIREIEARGLKSEGIYRVSGFSEHIEDVKMAFDRDGDKADISASVYADINII
AGALKLYFRDLPIPVITYNTYSKFIEAAKSSDPAERLEAINEALMMLPPAHYETLRFLIT
HLKKVTLLEKENLMNAENLGIVFGPTLMRPPEQSTLATLNDMRHQKLIVQLLIENEDILF
Download sequence
Identical sequences H3BAR2
ENSLACP00000018983 ENSLACP00000018983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]