SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BD91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BD91
Domain Number 1 Region: 501-579
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.11e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000128
Further Details:      
 
Domain Number 2 Region: 279-318
Classification Level Classification E-value
Superfamily WW domain 0.00000578
Family WW domain 0.0054
Further Details:      
 
Weak hits

Sequence:  H3BD91
Domain Number - Region: 616-684
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000513
Family Double-stranded RNA-binding domain (dsRBD) 0.016
Further Details:      
 
Domain Number - Region: 9-22
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BD91
Sequence length 771
Comment (tr|H3BD91|H3BD91_LATCH) DGCR8, microprocessor complex subunit {ECO:0000313|Ensembl:ENSLACP00000019862} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=DGCR8 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MNEESQPCPPPLPPNQQPPPPPLQTSSDAELMDVGSGGDGQFVTPAGDSNTCNKELLLTK
GSASYNSRLVEDLETRDQSPRTARHAPPVPKFVPDLKLLKDVKISVSFTESCKSKDRKVL
YTGFEEELEADVGLNSESLNGDLHDLLNSSDGKAGGSNGENDDRRESDNDTYQEKRVEFA
VLDELEEFTDNVMETDGEGAGFVSEAIIQQSQVDEEAFNYSYEEDFDNDVDALLEEGLPV
PKKKMRMEEKYGAESDHQSDGEMSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGI
PVYLHRESRVVTWSRPYFLGTGSIRKHDPPVSSIPCLHYKKMKAQEEKEQNGEVTPNGEQ
SPVKSTDLPSDSGERDEEPDSTANEETLAADAAPAEAVGSGTCEDKDVAGGDSAQGALGQ
VKAKVEVCKDESVDIEEFKSYLKKRFDFEQVTVKKFRTWAERRQFNREMKRKQAEAERPI
LPANQKLITLSVQDAPMKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPF
GASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSDELEYFNHIS
IEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMACGKHTV
RGWCKXKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESNKMVKQETSDKSVIELQQYA
KKNKPNLHILNKLQEEMRKLAREREETRKKPKMSVMESAQPGSEPLCTVDV
Download sequence
Identical sequences H3BD91
ENSLACP00000019862 ENSLACP00000022436 ENSLACP00000019862 XP_014340643.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]