SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BE25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BE25
Domain Number 1 Region: 25-122
Classification Level Classification E-value
Superfamily DEATH domain 1.93e-18
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BE25
Sequence length 567
Comment (tr|H3BE25|H3BE25_LATCH) Caspase recruitment domain family member 9 {ECO:0000313|Ensembl:ENSLACP00000020146} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CARD9 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MLRREAHDFQYFTMSALSDLDGDDEECWNSLERFRVKLISVIEPSRITPYLRQCKVMNHD
DEEQLYSDPSLVLRKRRVGVLLDMLQRTGHKGYVAFLESLELYYPDLYKKLTGKDPSRVF
SMIIDTAGESSLGQLLMNEVMKLQQVIQEEKHKIRELNQQLNAKEDIIKQLQVKDNELRK
HQERFRKMKEERDNFSEELKKCKDENYELALRLARLSEEKNTALMKNRDLQLEIEKLKHN
LMKAEDDCKVERKHTMKLKHAMEQRPSQEVIWEVRRENDLLKAQIQELQSSMQVTKEDSS
EKNKMYIQILEDDRRLALEEHQEKVNTIYTLRKEFRQAEELRDKYMEEKEVFELQCMNLK
KDSKMYKERIEAILQQMEEVTAERDQALRTREQFHLQYSKSLVDKDMYRKQIQELGEKYD
ELQIQLFKTEGQLLALETKLKRVNLEPPTPTSDVDDISPRSSQDLFNPRIPDDVQNVKKD
QPKSDLPYGRQDSWMKEAELPKSTENRDDFFKNDGPSNGKPHRQERRFHISFDHRRKRAL
RLRNDTGQEGVDCENTTGSDNTDTEGT
Download sequence
Identical sequences H3BE25
XP_005987448.1.90931 ENSLACP00000020146 ENSLACP00000020146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]