SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BE52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3BE52
Domain Number - Region: 145-315
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00146
Family gamma-Butyrobetaine hydroxylase 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BE52
Sequence length 355
Comment (tr|H3BE52|H3BE52_LATCH) 2-oxoglutarate and iron dependent oxygenase domain containing 2 {ECO:0000313|Ensembl:ENSLACP00000020173} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=OGFOD2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MSDPEASACKKQFYVCGCFYTNNIFLEDYKIHVTFLNEQQFRRDYGPVLRNAGCTTEEKF
KDVFAKIEKELQRRQLLDQHSMERKAIISETYEPIHPHVYMLQESFLAPKFVEVVNYCQS
EDADLKGLLDRIDSLPAKKVYSFPVFTKEFCQDLVEELENFEQSKMPRSRPNTMNNFGIQ
LNELGFDETFITPLRENYLQPITSLLFPDYGGKCLDSHKVFVVKYALHEDLSLSYHYDNA
EVTLNVSLGKQFTEGNLYFGDVRQVPISETECVEVEHQVTQGLLHQGGQLHGALPIKSGE
RWNLIVWMRSSAVRNRLCPMCNMQPHLVEAIGFGDGYTKDTAEEIPDNVDVCTLI
Download sequence
Identical sequences H3BE52
ENSLACP00000020173 ENSLACP00000020173 XP_005989018.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]