SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BEU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BEU0
Domain Number 1 Region: 292-391
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000138
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 21-146
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000342
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BEU0
Sequence length 442
Comment (tr|H3BEU0|H3BEU0_LATCH) SH2 domain containing 5 {ECO:0000313|Ensembl:ENSLACP00000020411} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=SH2D5 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
LAQCGADGSPLGTETGKLNYTRDCLHILLQYVGSFAVEGQEKDDKTKKIQQQLQALKVEK
KKKKKKKSFKIKAIIEVLKSEGETVLMAHALRRIFYSTCCSADCQFAFVARNPNQHELYC
HLFVGAQPSEVPVLNLLLCRMFQLSYLQNCPEARNKTLLTPSSPETVGSHWRSLRSPLTR
EPFQSEEVSLNINALVSIKRLSYQNIIENEGKKVVNFESQKPLTHLHIDSPYVSPTLVRK
KAIRNKVIRSGAYRSINYASQLQRSVHESFFPPVVLHPWRCGESESCQFIHFPKNEDLLM
EAVWSFAGISRECGEALLKQDVLGSFMLWETPEKINCWSLTVRTPFGIIVYQIYKSHLGK
YCMEHLQTEFPSMEALIKHHMESKGGLLCCLDISRINYCYVEQDGTGSPGLGLPLDPCEN
LDPIVESTPLGEETKVVEVALV
Download sequence
Identical sequences H3BEU0
ENSLACP00000020411 ENSLACP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]