SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BG05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BG05
Domain Number 1 Region: 737-1070
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-110
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000000015
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 2.35e-46
Family USP8 N-terminal domain-like 0.00000159
Further Details:      
 
Domain Number 3 Region: 168-322
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 7.67e-30
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.00000384
Further Details:      
 
Weak hits

Sequence:  H3BG05
Domain Number - Region: 611-646
Classification Level Classification E-value
Superfamily WW domain 0.013
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BG05
Sequence length 1082
Comment (tr|H3BG05|H3BG05_LATCH) Ubiquitin specific peptidase 8 {ECO:0000313|Ensembl:ENSLACP00000020826} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=USP8 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MPAVSSVPKELYISTSLKELNRKAEVKPEKISTRSYVQSACKLFKTAEENRLDRDEERAY
VLYMKYLSVYELIKNRTDFKRQQDYYLSLLGPTSFKKAVEEAEKLSESLKLRYEEAEVRK
KLEERERIEEQKKEQEAARNEEKIFTNNSSVDIADSAKENQKVNGDHYYVPVLVARAPGS
ITAEKLYGMVKDQGISIIIMDARSLKDYLESHIQVPEQCCISVPEEAISPGITVNQIEAK
LPNESKVLWMNRGFVDYIVLLDWFSTINELTLGTTLQSLKDALFKWDSQTILRSEPLVLE
GGYENWLLCYPMYTTNAKVVPPKTENTGSVSVLLNFSYPTLEEPAASVQPEISPVEINEK
IESPETMATGDKTPTGPLPAGANSVPAPKAGDPSACQPANVMKVIPQIDRTKKPSLKMQT
NKPKPETTVADHPHIQNGRLIPDRSTKPPLDPKNVLTEEEKNRIHVETALLMEKAKREKE
QRERERLEQKQREQEEREQKEKDDAERKEKEQKAREAEKEQREKEERERQLELERKRREG
IEEERTEAEKAELEEKKNVEKREQTKITGETAEVQKKTVEEESASVAVDTRTVKTQREPL
TRARSEEMGRTVPGLPEGWMKFLDIVTGTFRYYHSPTNSVHMYPPEMAPSVTPPATPPTH
KAKQQAQAELDREHSKLKRSYSSPDITRAIQEEGKKKATVTPTVNRETKPTSYTKTEIAR
PSASQIRNLNPVFGGLGPGLTGLRNLGNTCYMNSVLQCLSNTPHLAEYFIRNYYQEDINR
ANILGHKGEVAEEFGVIMKALWAGQYRYLSPRDFKITIGRINDQFAGYAQQDSQELLLFL
MDGLHEDLNKADNRKRHKEENNDNLNDLKASEQAWSKHKQLNESIIVALFQGQFKSTVQC
LTCLKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCGHCKTQRDSLK
KIEIWKLPPILLVHLKRFSYEGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKRYNLYGV
SNHYGGLDGGHYTAYCKNVIKQRWNKFDDHEVSEISTSSVKSSAAYILFYSSLELRAADI
AT
Download sequence
Identical sequences H3BG05
ENSLACP00000020826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]