SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BG21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BG21
Domain Number 1 Region: 52-81
Classification Level Classification E-value
Superfamily WW domain 0.0000129
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BG21
Sequence length 1474
Comment (tr|H3BG21|H3BG21_LATCH) Centrosomal protein 164 {ECO:0000313|Ensembl:ENSLACP00000020842} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CEP164 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
IMTAALQIGDQLILEEDYDDSYIPSEQVLLAFFSPQGLWWLAIYLLLYKVPGNGYCESQD
VTGDVYYFNFATGQSTWDHPCDEHYRTLVNQERERLQVQNAAKKKDKKRKKEKKEKKEKR
DQLKPPLALSSPLAPVQSLGLPQAPLGGLAPLRGLVDSSGSTLRGSLGSTASSSGGLELA
TTQLGSSGTIGGLRAGGLSAGLLGMKHEERVSLTLPGLEEDQEDESQNESPRGTARLMRN
LHMDVGSLGGGFEYEKEDSLRESQIEGRDKTPLDSGSHGACPPTPHRTGLGKETDLDSDL
SEGEPKAKSETAGQEVESDPNHNHGAENAKMKFKQRRGVLSKGAAILISDEEEKEDKENH
SSSTDGTGRQSRLAMGGEAVGDKEKDIIKMKDGIRESEPSEQIKELHLSGPLEDLSNKDK
VSFNTKEFGFRSRVSEQVMDVEALLPALSDTEKEICKPIQPVSPHSDTEKADNYLLIYIK
KILSDRNLYPNCPCKSGAEKTVEKVSLEEERTKRAEAAERWWEKSVLGLIFKTGKEKKMG
RLGEGEPNPLVNGPMTVDQRSEEQGNKEASRLERFEREDVEASNQAQLAPPAEERIRQKE
TLKRPSQESLEESQREADTKLEQERSRIRREEEERILKLREELRREEEEKARELHQEKEN
KLRSVSHCGKNSIVSRDDRKRADILNRVPTILCRVFQKGCRRVEVGIRAMKYGGKRLMRS
GVALASPAPVRALEALEKRQALELKELKSTAEEKHQKVNLCSVNFSKEQQRNGCIVELHK
VRSLLQMDHCCHLQVLLLYERHIALVSSLQKQITEVQSSEEVQLQGDLRRAQQKVQQAAD
YERELGDLLKEKRKEVEKEHGQKMEKMKEEHQQTLERIRDDYEEEERKLREKLLRSLKEE
CERLTGAHEREITGLRRDLEQRLSELQQNHRDKETKLQDLENQLELRSREIKAKAAQFKS
QEELIRKQRQQLHDEEEQLTKERAEAPSARLCKQELEESRLELHSVKGSIRQSRGDLEQL
QQRKAELESEVETLQNKIETLQSRVSELEAGVQKREEAIKETLVSNDVSLAGEEVEGALC
VEDLRKSLKTAQKVGSSSRTEEEEDVSIDDLRHYISAEGASIKKAKEFLTRQTRSLRKRQ
AALKAAKRQWCHDLLKVEGEVQGPESSLILEDARKSLDQESKHLDEMKSAMRKGQVLLRK
KEEKLNQLESSLLEELSDEDTLKGTGYKKVVTFDLSDSDDLSSIISTDLPALKIWGVSVV
DLKPVLTLPHPSKVQYLSDSLQRITSDLNTVLSVLGSLGKQQSPLFTSTQFLAPSPPSEG
VPLSAYTSLTRTPATGSCNSIPLPKQWAWSTGANPNLSASTAQSVDDILTEKWSKYFPGG
IQSLSANPAPLNGRPGYISASEQIRLLQRSQLRVPETDRNAIQGMIDANKKWLDSFKKDP
KFSPLFTKTNKTPSNHGILQLGLDENNQIKVYHY
Download sequence
Identical sequences H3BG21
ENSLACP00000020842 ENSLACP00000020842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]