SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BK39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BK39
Domain Number 1 Region: 306-492,605-824,854-884
Classification Level Classification E-value
Superfamily Ras GEF 1.15e-102
Family Ras GEF 0.00047
Further Details:      
 
Domain Number 2 Region: 55-185
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-30
Family DEP domain 0.0000448
Further Details:      
 
Domain Number 3 Region: 514-613
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-26
Family Ras-binding domain, RBD 0.0083
Further Details:      
 
Domain Number 4 Region: 179-308
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-25
Family cAMP-binding domain 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BK39
Sequence length 884
Comment (tr|H3BK39|H3BK39_MOUSE) Rap guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSMUSP00000135238} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rapgef3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVLKRMHRPRCCSYQLVFEHRRPSCIQGLRWTPLTNSEDSLDFRVSLEQATTEHVHKAGK
LLHRHLLATYPTLIRDRKYHLRLYRHCCSGRELVDGILALGLGVHSRSQAVGICQVLLDE
GALCHVKHDWTFQDRDAQFYRFPGPEPEPTGTQDVEEELVEAMALLSQRGPDALLTVALR
KPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTS
WYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILRENNCHFLRVDKQDF
NRIIKDVEAKTMRLEEHGKVVLVLERTSQGAGPSRPPTPGRNRYTVMSGTPEKILELLLE
AMRPDSSAHDPTETFLSDFLLTHSVFMPSTQLFTALLHHFHVEPADPAGGSEQEHSTYIC
NKRQQILRLVGRWVALYSPMLHSDPVATSFLQKLSDLVSRDARLSNLLREQYPERRRHHR
LENGCGNVSPQTKARNAPVWLPNQEEPLPSSAGAIRVGDKVPYDICRPDHSVLTLHLPVT
ASVREVMAALAHEDHWTKGQVLVKVNSAGDVVGLQPDARGVATSLGLNERLFVVDPQEVH
ELTPHPEQLGPTLGSSEMLDLVSAKDLAGQLTDHDWNLFNRIHQVELIHYVLGPQHLRDV
TTANLERFMRRFNELQYWVATELCLCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMF
GLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLL
KDVTFIHEGNHTLVENLINFEKMRMMARAVRMLHHCRSHSTAPLSPLRSRVSHIHEDSQG
SRISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences H3BK39
ENSMUSP00000135238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]